Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00754-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-26 (13) GCLDSAGPWTMSR PA
1
27-48 (22) ALRPPLPPLCFFLLLLAAAGAR PA
1
49-79 (31) AGGYETCPTVQPNMLNVHLLPHTHDDVGWLK PA
1
80-89 (10) TVDQYFYGIK PA
1
90-114 (25) NDIQHAGVQYILDSVISALLADPTR PA
1
116-126 (11) FIYVEIAFFSR PA
1
127-140 (14) WWHQQTNATQEVVR PA
1
148-177 (30) LEFANGGWVMNDEAATHYGAIVDQMTLGLR PA
1
178-190 (13) FLEDTFGNDGRPR PA
1
191-202 (12) VAWHIDPFGHSR PA
1
203-220 (18) EQASLFAQMGFDGFFFGR PA
1
233-240 (8) LEMEQVWR PA
1
241-265 (25) ASTSLKPPTADLFTGVLPNGYNPPR PA
1
266-283 (18) NLCWDVLCVDQPLVEDPR PA
1
291-305 (15) ELVDYFLNVATAQGR PA
1
309-330 (22) TNHTVMTMGSDFQYENANMWFK PA
1
338-345 (8) LVNAQQAK PA
0
346-365 (20) GSSVHVLYSTPACYLWELNK PA
1
366-373 (8) ANLTWSVK PA
1
374-399 (26) HDDFFPYADGPHQFWTGYFSSRPALK PA
1
404-454 (51) LSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSR PA
1
455-463 (9) QHVANDYAR PA
1
464-482 (19) QLAAGWGPCEVLLSNALAR PA
1
488-509 (22) DHFTFCQQLNISICPLSQTAAR PA
1
510-520 (11) FQVIVYNPLGR PA
1
528-538 (11) LPVSEGVFVVK PA
1
544-585 (42) TVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPR PA
1
600-613 (14) SWSPALTIENEHIR PA
1
614-638 (25) ATFDPDTGLLMEIMNMNQQLLLPVR PA
1
639-674 (36) QTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSR PA
1
675-682 (8) WAQIHLVK PA
1
683-702 (20) TPLVQEVHQNFSAWCSQVVR PA
1
709-727 (19) HLELEWSVGPIPVGDTWGK PA
1
733-740 (8) FDTPLETK PA
1
743-750 (8) FYTDSNGR PA
1
765-781 (17) LNQTEPVAGNYYPVNTR PA
1
782-797 (16) IYITDGNMQLTVLTDR PA
1
798-805 (8) SQGGSSLR PA
1
806-815 (10) DGSLELMVHR PA
1
824-839 (16) GVSEPLMENGSGAWVR PA
1
842-857 (16) HLVLLDTAQAAAAGHR PA
1
858-886 (29) LLAEQEVLAPQVVLAPGGGAAYNLGAPPR PA
1
895-916 (22) DLPPSVHLLTLASWGPEMVLLR PA
1
917-929 (13) LEHQFAVGEDSGR PA
1
930-940 (11) NLSAPVTLNLR PA
1
941-950 (10) DLFSTFTITR PA
1
951-962 (12) LQETTLVANQLR PA
1
970-998 (29) WTTNTGPTPHQTPYQLDPANITLEPMEIR PA
1
999-1007 (9) TFLASVQWK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center