Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00754-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-26 (13) GCLDSAGPWTMSR PA
1
27-48 (22) ALRPPLPPLCFFLLLLAAAGAR PA
1
49-79 (31) AGGYETCPTVQPNMLNVHLLPHTHDDVGWLK PA
1
80-89 (10) TVDQYFYGIK PA
1
90-114 (25) NDIQHAGVQYILDSVISALLADPTR PA
1
116-126 (11) FIYVEIAFFSR PA
1
127-140 (14) WWHQQTNATQEVVR PA
1
148-177 (30) LEFANGGWVMNDEAATHYGAIVDQMTLGLR PA
1
178-190 (13) FLEDTFGNDGRPR PA
1
191-202 (12) VAWHIDPFGHSR PA
1
203-220 (18) EQASLFAQMGFDGFFFGR PA
1
233-240 (8) LEMEQVWR PA
1
241-265 (25) ASTSLKPPTADLFTGVLPNGYNPPR PA
1
266-283 (18) NLCWDVLCVDQPLVEDPR PA
1
291-305 (15) ELVDYFLNVATAQGR PA
1
309-330 (22) TNHTVMTMGSDFQYENANMWFK PA
1
345-364 (20) GSSVHVLYSTPACYLWELNK PA
1
365-372 (8) ANLTWSVK PA
1
373-398 (26) HDDFFPYADGPHQFWTGYFSSRPALK PA
1
403-453 (51) LSYNFLQVCNQLEALVGLAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSR PA
1
454-462 (9) QHVANDYAR PA
1
463-481 (19) QLAAGWGPCEVLLSNALAR PA
1
487-508 (22) DHFTFCQQLNISICPLSQTAAR PA
1
509-519 (11) FQVIVYNPLGR PA
1
527-537 (11) LPVSEGVFVVK PA
1
543-584 (42) TVPSDVVIFPSSDSQAHPPELLFSASLPALGFSTYSVAQVPR PA
1
599-612 (14) SWSPALTIENEHIR PA
1
613-637 (25) ATFDPDTGLLMEIMNMNQQLLLPVR PA
1
638-673 (36) QTFFWYNASIGDNESDQASGAYIFRPNQQKPLPVSR PA
1
674-681 (8) WAQIHLVK PA
1
682-701 (20) TPLVQEVHQNFSAWCSQVVR PA
1
708-726 (19) HLELEWSVGPIPVGDTWGK PA
1
732-739 (8) FDTPLETK PA
1
742-749 (8) FYTDSNGR PA
1
764-780 (17) LNQTEPVAGNYYPVNTR PA
1
781-796 (16) IYITDGNMQLTVLTDR PA
1
797-804 (8) SQGGSSLR PA
1
805-814 (10) DGSLELMVHR PA
1
823-838 (16) GVSEPLMENGSGAWVR PA
1
841-856 (16) HLVLLDTAQAAAAGHR PA
1
857-885 (29) LLAEQEVLAPQVVLAPGGGAAYNLGAPPR PA
1
894-915 (22) DLPPSVHLLTLASWGPEMVLLR PA
1
916-928 (13) LEHQFAVGEDSGR PA
1
929-939 (11) NLSAPVTLNLR PA
1
940-949 (10) DLFSTFTITR PA
1
950-961 (12) LQETTLVANQLR PA
1
969-997 (29) WTTNTGPTPHQTPYQLDPANITLEPMEIR PA
1
998-1006 (9) TFLASVQWK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center