Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14493-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MASMGLQVMGIALAVLGWLAVMLCCALPMWR PA
0
32-65 (34) VTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCK PA
0
66-81 (16) VYDSLLALPQDLQAAR PA
3
82-103 (22) ALVIISIIVAALGVLLSVVGGK PA
0
104-114 (11) CTNCLEDESAK PA
0
117-157 (41) TMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQK PA
0
159-188 (30) EMGASLYVGWAASGLLLLGGGLLCCNCPPR PA
0
189-196 (8) TDKPYSAK PA
0
202-209 (8) SAAASNYV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center