Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14559-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-29 (25) STDSLDGPGEGSVQPLPTAGGPSVK PA
2
46-70 (25) LADCAHFHYENVDFGHIQLLLSPDR PA
2
71-92 (22) EGPSLSGENELVFGVQVTCQGR PA
2
105-112 (8) SLDAHLHR PA
2
119-133 (15) FSCLPELPPPPEGAR PA
2
134-173 (40) AAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR PA
1
175-195 (21) LLLSEEASLNIPAVAAAHVIK PA
2
197-224 (28) YTAQAPDELSFEVGDIVSVIDMPPTEDR PA
2
232-255 (24) GFQVGFFPSECVELFTERPGPGLK PA
2
256-282 (27) ADADGPPCGIPAPQGISSLTSAVPRPR PA
2
312-333 (22) VFGCDLGEHLSNSGQDVPQVLR PA
2
334-350 (17) CCSEFIEAHGVVDGIYR PA
2
351-360 (10) LSGVSSNIQR PA
2
370-390 (21) IPELSGPAFLQDIHSVSSLCK PA
2
395-408 (14) ELPNPLLTYQLYGK PA
2
409-421 (13) FSEAMSVPGEEER PA
2
425-438 (14) VHDVIQQLPPPHYR PA
2
453-462 (10) HSANTSMHAR PA
2
463-474 (12) NLAIVWAPNLLR PA
9
475-490 (16) SMELESVGMGGAAAFR PA
2
494-524 (31) VQSVVVEFLLTHVDVLFSDTFTSAGLDPAGR PA
2
532-541 (10) SLAGSCPSTR PA
2
542-551 (10) LLTLEEAQAR PA
4
556-566 (11) LGTPTEPTTPK PA
2
567-574 (8) APASPAER PA
2
585-592 (8) KPGGSSWK PA
2
607-616 (10) KPLPWLGGTR PA
2
617-632 (16) APPQPSGSRPDTVTLR PA
2
636-651 (16) SEESLSSQASGAGLQR PA
1
657-713 (57) RPHSSSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHR PA
1
714-730 (17) TSAWLDDGDELDFSPPR PA
1
737-746 (10) GLDFDPLTFR PA
1
747-773 (27) CSSPTPGDPAPPASPAPPAPASAFPPR PA
1
774-782 (9) VTPQAISPR PA
1
783-830 (48) GPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGR PA
1
831-842 (12) SLRPHLIPLLLR PA
2
843-859 (17) GAEAPLTDACQQEMCSK PA
2
862-894 (33) GAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPK PA
2
899-907 (9) LMALALAER PA
2
908-933 (26) AQQVAEQQSQQECGGTPPASQSPFHR PA
2
934-972 (39) SLSLEVGGEPLGTSGSGPPPNSLAHPGAWVPGPPPYLPR PA
2
973-981 (9) QQSDGSLLR PA
2
982-990 (9) SQRPMGTSR PA
2
995-1004 (10) GPAQVSAQLR PA
1
1011-1038 (28) DAPEAAAQSPCSVPSQVPTPGFFSPAPR PA
1
1039-1070 (32) ECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWR PA
2
1071-1081 (11) SSLGPPAPLDR PA
2
1082-1102 (21) GENLYYEIGASEGSPYSGPTR PA
2
1115-1130 (16) LNASYGMLGQSPPLHR PA
2
1131-1160 (30) SPDFLLSYPPAPSCFPPDHLGYSAPQHPAR PA
2
1161-1177 (17) RPTPPEPLYVNLALGPR PA
2
1178-1194 (17) GPSPASSSSSSPPAHPR PA
2
1197-1205 (9) SDPGPPVPR PA
2
1222-1236 (15) VPGPWGPPEPLLLYR PA
2
1237-1244 (8) AAPPAYGR PA
2
1261-1284 (24) GEGAGPPPPYPTPSWSLHSEGQTR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center