Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14559-10)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-37 (37) MLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR PA
0
39-59 (21) LLLSEEASLNIPAVAAAHVIK PA
2
61-88 (28) YTAQAPDELSFEVGDIVSVIDMPPTEDR PA
2
96-119 (24) GFQVGFFPSECVELFTERPGPGLK PA
2
120-146 (27) ADADGPPCGIPAPQGISSLTSAVPRPR PA
2
176-197 (22) VFGCDLGEHLSNSGQDVPQVLR PA
2
198-214 (17) CCSEFIEAHGVVDGIYR PA
2
215-224 (10) LSGVSSNIQR PA
2
234-254 (21) IPELSGPAFLQDIHSVSSLCK PA
2
259-272 (14) ELPNPLLTYQLYGK PA
2
273-285 (13) FSEAMSVPGEEER PA
2
289-302 (14) VHDVIQQLPPPHYR PA
2
317-326 (10) HSANTSMHAR PA
2
327-338 (12) NLAIVWAPNLLR PA
9
339-354 (16) SMELESVGMGGAAAFR PA
2
358-388 (31) VQSVVVEFLLTHVDVLFSDTFTSAGLDPAGR PA
2
396-405 (10) SLAGSCPSTR PA
2
406-415 (10) LLTLEEAQAR PA
4
420-430 (11) LGTPTEPTTPK PA
2
431-438 (8) APASPAER PA
2
449-456 (8) KPGGSSWK PA
2
471-480 (10) KPLPWLGGTR PA
2
481-496 (16) APPQPSGSRPDTVTLR PA
2
500-515 (16) SEESLSSQASGAGLQR PA
1
521-577 (57) RPHSSSDAFPVGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHR PA
1
578-594 (17) TSAWLDDGDELDFSPPR PA
1
601-610 (10) GLDFDPLTFR PA
1
611-637 (27) CSSPTPGDPAPPASPAPPAPASAFPPR PA
1
638-646 (9) VTPQAISPR PA
1
647-694 (48) GPTSPASPAALDISEPLAVSVPPAVLELLGAGGAPASATPTPALSPGR PA
1
695-706 (12) SLRPHLIPLLLR PA
2
707-723 (17) GAEAPLTDACQQEMCSK PA
2
726-758 (33) GAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPK PA
2
763-771 (9) LMALALAER PA
2
772-797 (26) AQQVAEQQSQQECGGTPPASQSPFHR PA
2
798-836 (39) SLSLEVGGEPLGTSGSGPPPNSLAHPGAWVPGPPPYLPR PA
2
837-845 (9) QQSDGSLLR PA
2
846-854 (9) SQRPMGTSR PA
2
859-874 (16) GPAQVPTPGFFSPAPR PA
0
875-906 (32) ECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWR PA
2
907-917 (11) SSLGPPAPLDR PA
2
918-938 (21) GENLYYEIGASEGSPYSGPTR PA
2
951-966 (16) LNASYGMLGQSPPLHR PA
2
967-996 (30) SPDFLLSYPPAPSCFPPDHLGYSAPQHPAR PA
2
997-1013 (17) RPTPPEPLYVNLALGPR PA
2
1014-1030 (17) GPSPASSSSSSPPAHPR PA
2
1033-1041 (9) SDPGPPVPR PA
2
1058-1072 (15) VPGPWGPPEPLLLYR PA
2
1073-1080 (8) AAPPAYGR PA
2
1097-1120 (24) GEGAGPPPPYPTPSWSLHSEGQTR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center