Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14559-11)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-29 (25) STDSLDGPGEGSVQPLPTAGGPSVK PA
2
46-70 (25) LADCAHFHYENVDFGHIQLLLSPDR PA
2
71-92 (22) EGPSLSGENELVFGVQVTCQGR PA
2
105-112 (8) SLDAHLHR PA
2
119-133 (15) FSCLPELPPPPEGAR PA
2
134-173 (40) AAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR PA
1
175-195 (21) LLLSEEASLNIPAVAAAHVIK PA
2
197-224 (28) YTAQAPDELSFEVGDIVSVIDMPPTEDR PA
2
232-255 (24) GFQVGFFPSECVELFTERPGPGLK PA
2
256-282 (27) ADADGPPCGIPAPQGISSLTSAVPRPR PA
2
312-333 (22) VFGCDLGEHLSNSGQDVPQVLR PA
2
334-350 (17) CCSEFIEAHGVVDGIYR PA
2
351-360 (10) LSGVSSNIQR PA
2
370-390 (21) IPELSGPAFLQDIHSVSSLCK PA
2
395-408 (14) ELPNPLLTYQLYGK PA
2
409-421 (13) FSEAMSVPGEEER PA
2
425-438 (14) VHDVIQQLPPPHYR PA
2
453-462 (10) HSANTSMHAR PA
2
463-474 (12) NLAIVWAPNLLR PA
9
475-490 (16) SMELESVGMGGAAAFR PA
2
494-524 (31) VQSVVVEFLLTHVDVLFSDTFTSAGLDPAGR PA
2
532-541 (10) SLAGSCPSTR PA
2
542-551 (10) LLTLEEAQAR PA
4
556-566 (11) LGTPTEPTTPK PA
2
567-574 (8) APASPAER PA
2
585-592 (8) KPGGSSWK PA
2
607-616 (10) KPLPWLGGTR PA
2
617-632 (16) APPQPSGSRPDTVTLR PA
2
636-669 (34) SEESLSSQASGAELLGAGGAPASATPTPALSPGR PA
0
670-681 (12) SLRPHLIPLLLR PA
2
682-698 (17) GAEAPLTDACQQEMCSK PA
2
701-733 (33) GAQGPLGPDMESPLPPPPLSLLRPGGAPPPPPK PA
2
738-746 (9) LMALALAER PA
2
747-772 (26) AQQVAEQQSQQECGGTPPASQSPFHR PA
2
773-811 (39) SLSLEVGGEPLGTSGSGPPPNSLAHPGAWVPGPPPYLPR PA
2
812-820 (9) QQSDGSLLR PA
2
821-829 (9) SQRPMGTSR PA
2
834-843 (10) GPAQVSAQLR PA
1
850-877 (28) DAPEAAAQSPCSVPSQVPTPGFFSPAPR PA
1
878-909 (32) ECLPPFLGVPKPGLYPLGPPSFQPSSPAPVWR PA
2
910-920 (11) SSLGPPAPLDR PA
2
921-941 (21) GENLYYEIGASEGSPYSGPTR PA
2
954-969 (16) LNASYGMLGQSPPLHR PA
2
970-999 (30) SPDFLLSYPPAPSCFPPDHLGYSAPQHPAR PA
2
1000-1016 (17) RPTPPEPLYVNLALGPR PA
2
1017-1033 (17) GPSPASSSSSSPPAHPR PA
2
1036-1044 (9) SDPGPPVPR PA
2
1061-1075 (15) VPGPWGPPEPLLLYR PA
2
1076-1083 (8) AAPPAYGR PA
2
1100-1123 (24) GEGAGPPPPYPTPSWSLHSEGQTR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center