Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14559-12)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MLSLSLCSHLWGPLILSALQAR PA
0
23-47 (25) STDSLDGPGEGSVQPLPTAGGPSVK PA
2
64-88 (25) LADCAHFHYENVDFGHIQLLLSPDR PA
2
89-110 (22) EGPSLSGENELVFGVQVTCQGR PA
2
123-130 (8) SLDAHLHR PA
2
137-151 (15) FSCLPELPPPPEGAR PA
2
152-190 (39) AAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMEVGLGR PA
0
191-199 (9) GLGDSEWVR PA
0
200-209 (10) GCVCHHAQHR PA
0
217-234 (18) VASAVEDEGAEVDGEAFR PA
0
235-246 (12) WGSLWVGESWDM PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center