Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14576-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
44-54 (11) EPVQDDSDLDR PA
4
58-101 (44) ETEALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSK PA
1
102-122 (21) SVSTPSEAGSQDSGDLGPLTR PA
4
123-143 (21) TLQWDTDPSVLQLQSDSELGR PA
1
153-161 (9) VTQVDFLPR PA
4
169-192 (24) ETQTPLATHQSEEDEEDEEMVESK PA
4
193-204 (12) VGQDSELENQDK PA
4
222-236 (15) QQILHSEEFLIFFDR PA
4
244-258 (15) ALAEDSDIFFDYSGR PA
4
264-277 (14) DGDVQAGANLSFNR PA
4
278-286 (9) QFYDEHWSK PA
4
289-327 (39) VVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMK PA
4
331-350 (20) TTPEYVFHCQSSVMSVCFAR PA
4
351-371 (21) FHPNLVVGGTYSGQIVLWDNR PA
10
381-414 (34) TPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGK PA
4
415-436 (22) MCSWSLDMLSTPQESMELVYNK PA
4
437-469 (33) SKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR PA
4
474-515 (42) AGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVK PA
4
521-556 (36) HNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGR PA
4
557-583 (27) LDLWNLNNDTEVPTASVAIEGASALNR PA
4
592-601 (10) EVAVGDSEGR PA
4
602-620 (19) IWVYDVGELAVPHNDEWTR PA
3
633-645 (13) ADSEEEGTVELSA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center