Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14576-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
44-54 (11) EPVQDDSDLDR PA
4
58-84 (27) ETEALLQSIGISPEPPLVPTPMSPSSK PA
2
85-105 (21) SVSTPSEAGSQDSGDLGPLTR PA
4
106-126 (21) TLQWDTDPSVLQLQSDSELGR PA
1
136-144 (9) VTQVDFLPR PA
4
152-175 (24) ETQTPLATHQSEEDEEDEEMVESK PA
4
176-187 (12) VGQDSELENQDK PA
4
205-219 (15) QQILHSEEFLIFFDR PA
4
227-241 (15) ALAEDSDIFFDYSGR PA
4
247-260 (14) DGDVQAGANLSFNR PA
4
261-269 (9) QFYDEHWSK PA
4
272-310 (39) VVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMK PA
4
314-333 (20) TTPEYVFHCQSSVMSVCFAR PA
4
334-354 (21) FHPNLVVGGTYSGQIVLWDNR PA
10
364-397 (34) TPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGK PA
4
398-419 (22) MCSWSLDMLSTPQESMELVYNK PA
4
420-452 (33) SKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR PA
4
457-498 (42) AGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVK PA
4
504-539 (36) HNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGR PA
4
540-566 (27) LDLWNLNNDTEVPTASVAIEGASALNR PA
4
575-584 (10) EVAVGDSEGR PA
4
585-603 (19) IWVYDVGELAVPHNDEWTR PA
3
616-628 (13) ADSEEEGTVELSA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center