Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14576-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
44-54 (11) EPVQDDSDLDR PA
4
58-84 (27) ETEALLQSIGISPEPPLVPTPMSPSSK PA
2
85-105 (21) SVSTPSEAGSQDSGDLGPLTR PA
4
116-124 (9) VTQVDFLPR PA
4
132-155 (24) ETQTPLATHQSEEDEEDEEMVESK PA
4
156-167 (12) VGQDSELENQDK PA
4
185-199 (15) QQILHSEEFLIFFDR PA
4
207-221 (15) ALAEDSDIFFDYSGR PA
4
227-240 (14) DGDVQAGANLSFNR PA
4
241-249 (9) QFYDEHWSK PA
4
252-290 (39) VVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMK PA
4
294-313 (20) TTPEYVFHCQSSVMSVCFAR PA
4
314-334 (21) FHPNLVVGGTYSGQIVLWDNR PA
10
344-377 (34) TPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGK PA
4
378-399 (22) MCSWSLDMLSTPQESMELVYNK PA
4
400-432 (33) SKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR PA
4
437-478 (42) AGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVK PA
4
484-519 (36) HNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGR PA
4
520-546 (27) LDLWNLNNDTEVPTASVAIEGASALNR PA
4
555-564 (10) EVAVGDSEGR PA
4
565-583 (19) IWVYDVGELAVPHNDEWTR PA
3
596-608 (13) ADSEEEGTVELSA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center