Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14576-5)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
44-54 (11) EPVQDDSDLDR PA
4
58-101 (44) ETEALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSK PA
1
102-122 (21) SVSTPSEAGSQDSGDLGPLTR PA
4
133-141 (9) VTQVDFLPR PA
4
149-172 (24) ETQTPLATHQSEEDEEDEEMVESK PA
4
173-184 (12) VGQDSELENQDK PA
4
202-216 (15) QQILHSEEFLIFFDR PA
4
224-238 (15) ALAEDSDIFFDYSGR PA
4
244-257 (14) DGDVQAGANLSFNR PA
4
258-266 (9) QFYDEHWSK PA
4
269-307 (39) VVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMK PA
4
311-330 (20) TTPEYVFHCQSSVMSVCFAR PA
4
331-351 (21) FHPNLVVGGTYSGQIVLWDNR PA
10
361-394 (34) TPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGK PA
4
395-416 (22) MCSWSLDMLSTPQESMELVYNK PA
4
417-449 (33) SKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR PA
4
454-495 (42) AGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVK PA
4
501-536 (36) HNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGR PA
4
537-563 (27) LDLWNLNNDTEVPTASVAIEGASALNR PA
4
572-581 (10) EVAVGDSEGR PA
4
582-600 (19) IWVYDVGELAVPHNDEWTR PA
3
613-625 (13) ADSEEEGTVELSA PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center