Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14581-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-80 (80) MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFADICFISTTIPK PA
0
81-90 (10) MLINIQTQSR PA
0
91-122 (32) VITYAGCITQMCFFVLFGGLDSLLLAVMAYDR PA
0
123-139 (17) FVAICHPLHYTVIMNPR PA
0
140-220 (81) LCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCELNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSK PA
0
227-234 (8) AISSAQGK PA
1
237-293 (57) AFSTCASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center