Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14593-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-67 (67) MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQGSSLK PA
0
68-75 (8) HSTTLTNR PA
2
78-100 (23) GNEVSALPATLDCDNLVNKPDER PA
1
101-118 (18) GFTPLIWASAFGEIETVR PA
2
119-132 (14) FLLEWGADPHILAK PA
2
135-142 (8) EVGLLLER PA
0
143-162 (20) DVDINIYDWNGGTPLLYAVR PA
2
168-175 (8) CVEALLAR PA
2
176-199 (24) GADLTTEADSGYTPMDLAVALGYR PA
2
201-211 (11) VQQVIENHILK PA
2
212-223 (12) LFQSNLVPADPE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center