Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14593-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-68 (68) MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLK PA
1
69-76 (8) HSTTLTNR PA
2
79-101 (23) GNEVSALPATLDCDNLVNKPDER PA
1
102-119 (18) GFTPLIWASAFGEIETVR PA
2
120-133 (14) FLLEWGADPHILAK PA
2
136-157 (22) ESALSLASTGGYTDIVGLLLER PA
1
158-177 (20) DVDINIYDWNGGTPLLYAVR PA
2
183-190 (8) CVEALLAR PA
2
191-214 (24) GADLTTEADSGYTPMDLAVALGYR PA
2
216-226 (11) VQQVIENHILK PA
2
227-238 (12) LFQSNLVPADPE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center