Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14730-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MDLVGVASPEPGTAAAWGPSK PA
1
22-45 (24) CPWAIPQNTISCSLADVMSEQLAK PA
1
46-90 (45) ELQLEEEAAVFPEVAVAEGPFITGENIDTSSDLMLAQMLQMEYDR PA
1
109-117 (9) VSISFENYR PA
1
119-138 (20) VHPYEDSDSSEDEVDWQDTR PA
1
139-152 (14) DDPYRPAKPVPTPK PA
1
166-173 (8) HDEVVCGR PA
1
179-197 (19) MENFAPEFQVGDGIGMDLK PA
1
198-207 (10) LSNHVFNALK PA
1
208-215 (8) QHAYSEER PA
1
244-261 (18) MVNSGMLETITGCISTGK PA
1
262-277 (16) ESVVFHAYGGSMEDEK PA
1
282-290 (9) VIPTECAIK PA
1
342-353 (12) AGIPCPTVVLLK PA
1
355-371 (17) HILVMSFIGHDQVPAPK PA
1
384-394 (11) EAYYQTLHLMR PA
1
395-418 (24) QLYHECTLVHADLSEYNMLWHAGK PA
1
419-441 (23) VWLIDVSQSVEPTHPHGLEFLFR PA
1
445-452 (8) NVSQFFQK PA
0
463-490 (28) ELFNAVSGLNITADNEADFLAEIEALEK PA
1
491-498 (8) MNEDHVQK PA
1
509-519 (11) DDGDPPLLYDE PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center