Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14733-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAASSLEQK PA
3
28-54 (27) IDLNLDISPQRPRPTLQLPLANDGGSR PA
2
55-72 (18) SPSSESSPQHPTPPARPR PA
3
73-85 (13) HMLGLPSTLFTPR PA
3
86-95 (10) SMESIEIDQK PA
3
102-112 (11) QTGYLTIGGQR PA
2
113-136 (24) YQAEINDLENLGEMGSGTCGQVWK PA
3
142-149 (8) TGHVIAVK PA
3
163-172 (10) ILMDLDVVLK PA
3
173-205 (33) SHDCPYIVQCFGTFITNTDVFIAMELMGTCAEK PA
3
210-217 (8) MQGPIPER PA
3
243-254 (12) DVKPSNILLDER PA
3
259-267 (9) LCDFGISGR PA
3
277-288 (12) SAGCAAYMAPER PA
3
289-302 (14) IDPPDPTKPDYDIR PA
3
303-323 (21) ADVWSLGISLVELATGQFPYK PA
2
327-334 (8) TDFEVLTK PA
3
335-358 (24) VLQEEPPLLPGHMGFSGDFQSFVK PA
3
374-381 (8) LLEHSFIK PA
3
383-395 (13) YETLEVDVASWFK PA
3
406-419 (14) TSGVLSQPHLPFFR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center