Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14733-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAASSLEQK PA
3
28-54 (27) IDLNLDISPQRPRPTLQLPLANDGGSR PA
2
55-72 (18) SPSSESSPQHPTPPARPR PA
3
73-85 (13) HMLGLPSTLFTPR PA
3
86-95 (10) SMESIEIDQK PA
3
102-118 (17) QTGYLTIGGQVPPSLWR PA
0
119-126 (8) GEGGGPAR PA
0
134-142 (9) QWGAGGGGR PA
0
143-155 (13) APGTLQPSLSSQR PA
0
156-179 (24) YQAEINDLENLGEMGSGTCGQVWK PA
3
185-192 (8) TGHVIAVK PA
3
206-215 (10) ILMDLDVVLK PA
3
216-248 (33) SHDCPYIVQCFGTFITNTDVFIAMELMGTCAEK PA
3
253-260 (8) MQGPIPER PA
3
286-297 (12) DVKPSNILLDER PA
3
302-310 (9) LCDFGISGR PA
3
320-331 (12) SAGCAAYMAPER PA
3
332-345 (14) IDPPDPTKPDYDIR PA
3
346-366 (21) ADVWSLGISLVELATGQFPYK PA
2
370-377 (8) TDFEVLTK PA
3
378-401 (24) VLQEEPPLLPGHMGFSGDFQSFVK PA
3
417-424 (8) LLEHSFIK PA
3
426-438 (13) YETLEVDVASWFK PA
3
449-462 (14) TSGVLSQPHLPFFR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center