Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14733-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAASSLEQK PA
3
28-56 (29) IDLNLDISPQRPRPIIVITLSPAPAPSQR PA
0
57-70 (14) AALQLPLANDGGSR PA
0
71-88 (18) SPSSESSPQHPTPPARPR PA
3
89-101 (13) HMLGLPSTLFTPR PA
3
102-111 (10) SMESIEIDQK PA
3
118-128 (11) QTGYLTIGGQR PA
2
129-152 (24) YQAEINDLENLGEMGSGTCGQVWK PA
3
158-165 (8) TGHVIAVK PA
3
179-188 (10) ILMDLDVVLK PA
3
189-221 (33) SHDCPYIVQCFGTFITNTDVFIAMELMGTCAEK PA
3
226-233 (8) MQGPIPER PA
3
259-270 (12) DVKPSNILLDER PA
3
275-283 (9) LCDFGISGR PA
3
293-304 (12) SAGCAAYMAPER PA
3
305-318 (14) IDPPDPTKPDYDIR PA
3
319-339 (21) ADVWSLGISLVELATGQFPYK PA
2
343-350 (8) TDFEVLTK PA
3
351-374 (24) VLQEEPPLLPGHMGFSGDFQSFVK PA
3
390-397 (8) LLEHSFIK PA
3
399-411 (13) YETLEVDVASWFK PA
3
422-435 (14) TSGVLSQPHLPFFR PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center