Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14735-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MPDENIFLFVPNLIGYAR PA
0
19-55 (37) IVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAAR PA
1
63-73 (11) FGAMLDMLTDR PA
2
74-115 (42) CSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVR PA
1
122-132 (11) MIDLSGNPVLR PA
1
133-173 (41) IYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFR PA
1
174-186 (13) MGLWVTAPIALLK PA
1
187-199 (13) SLISVIHLITAAR PA
1
200-209 (10) NMAALDAADR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center