Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14735-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MLPTAAGFSIWGQVGAAR PA
0
27-48 (22) ISSCSCPTSSVSAAHGPGPNER PA
0
51-63 (13) GLGGLPDPALSPR PA
0
64-71 (8) VPFQGYAR PA
0
72-108 (37) IVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAAR PA
1
116-126 (11) FGAMLDMLTDR PA
2
127-164 (38) CSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHR PA
0
165-176 (12) SAAILGAWATWR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center