Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14771-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MAAPLEAQDQAPGEGEGLLIVK PA
0
23-39 (17) VEDSSWEQESAQHEDGR PA
0
50-72 (23) QFCYGDVHGPHEAFSQLWELCCR PA
0
82-106 (25) EQILELLVLEQFLTVLPGEIQGWVR PA
0
107-125 (19) EQHPGSGEEAVALVEDLQK PA
0
133-147 (15) QDVPSEEAEPEAAGR PA
0
148-161 (14) GSQATGPPPTVGAR PA
0
163-182 (20) RPSVPQEQHSHSAQPPALLK PA
0
183-213 (31) EGRPGETTDTCFVSGVHGPVALGDIPFYFSR PA
0
214-224 (11) EEWGTLDPAQR PA
1
237-245 (9) NTTLGFGLK PA
1
251-287 (37) SLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPR PA
1
288-297 (10) AALGPVVGAR PA
1
310-324 (15) DLAAEKPHSCGQCGK PA
1
338-346 (9) THTGEKPHK PA
3
363-380 (18) HQGVHTGEKPFSCSECGK PA
1
385-393 (9) SAYLADHQR PA
1
394-408 (15) IHTGEKPFGCSDCGK PA
1
422-436 (15) VHTGERPFGCGECDK PA
1
442-453 (12) AHLIAHQSLHAK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center