Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14771-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-19 (9) LQAGDPRPR PA
0
36-55 (20) SSTAIAGPVALGDIPFYFSR PA
0
56-66 (11) EEWGTLDPAQR PA
1
79-87 (9) NTTLGFGLK PA
1
93-129 (37) SLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPR PA
1
130-139 (10) AALGPVVGAR PA
1
152-166 (15) DLAAEKPHSCGQCGK PA
1
180-188 (9) THTGEKPHK PA
3
205-222 (18) HQGVHTGEKPFSCSECGK PA
1
227-235 (9) SAYLADHQR PA
1
236-250 (15) IHTGEKPFGCSDCGK PA
1
264-278 (15) VHTGERPFGCGECDK PA
1
284-295 (12) AHLIAHQSLHAK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center