Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14787-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MDWQPDEQGLQQVLQLLK PA
1
19-29 (11) DSQSPNTATQR PA
1
37-54 (18) QLNQFPDFNNYLIFVLTR PA
1
64-71 (8) SLSGLILK PA
3
76-90 (15) AHYQSFPPPVADFIK PA
1
91-105 (15) QECLNNIGDASSLIR PA
1
106-118 (13) ATIGILITTIASK PA
1
119-152 (34) GELQMWPELLPQLCNLLNSEDYNTCEGAFGALQK PA
1
153-176 (24) ICEDSSELLDSDALNRPLNIMIPK PA
1
190-203 (14) SHAIACVNQFIMDR PA
1
204-230 (27) AQALMDNIDTFIEHLFALAVDDDPEVR PA
1
236-244 (9) ALVMLLEVR PA
4
248-262 (15) LIPHMHSIIQYMLQR PA
1
263-288 (26) TQDHDENVALEACEFWLTLAEQPICK PA
1
289-307 (19) EVLASHLVQLIPILVNGMK PA
1
308-317 (10) YSEIDIILLK PA
1
318-336 (19) GDVEEDEAVPDSEQDIKPR PA
1
342-373 (32) TVTLPHEAERPDGSEDAEDDDDDDALSDWNLR PA
1
375-388 (14) CSAAALDVLANVFR PA
1
389-400 (12) EELLPHLLPLLK PA
1
401-411 (11) GLLFHPEWVVK PA
1
412-447 (36) ESGILVLGAIAEGCMQGMVPYLPELIPHLIQCLSDK PA
1
453-461 (9) SIACWTLSR PA
1
462-484 (23) YAHWVVSQPPDMHLKPLMTELLK PA
1
493-529 (37) VQEAACSAFATLEEEACTELVPYLSYILDTLVFAFGK PA
1
534-561 (28) NLLILYDAIGTLADSVGHHLNQPEYIQK PA
1
562-569 (8) LMPPLIQK PA
1
579-608 (30) DLFPLLECLSSVATALQSGFLPYCEPVYQR PA
4
616-635 (20) TLAQAMMYTQHPEQYEAPDK PA
1
636-662 (27) DFMIVALDLLSGLAEGLGGHVEQLVAR PA
1
663-681 (19) SNIMTLLFQCMQDSMPEVR PA
1
682-693 (12) QSSFALLGDLTK PA
4
694-762 (69) ACFIHVKPCIAEFMPILGTNLNPEFISVCNNATWAIGEICMQMGAEMQPYVQMVLNNLVEIINRPNTPK PA
1
763-774 (12) TLLENTAITIGR PA
3
775-799 (25) LGYVCPQEVAPMLQQFIRPWCTSLR PA
4
813-843 (31) GICMMIGVNPGGVVQDFIFFCDAVASWVSPK PA
1
859-878 (20) DQVGEDNWQQFSEQFPPLLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center