Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14896-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-14 (8) EVPMNPVK PA
1
15-42 (28) IYQVCDIPQPQGSIINPGSTGSAPWDEK PA
1
43-99 (57) DNDVDEEDEEDELDQSQHHVPIQDTFPFLNINGSPMAPASVGNCSVGNCSPEAVWPK PA
1
100-134 (35) TEPLEMEVPQAPIQPFYSSPELWISSLPMTDLDIK PA
1
141-155 (15) EYGQTMTVSNPQGCR PA
1
156-180 (25) LFYGDLGPMPDQEELFGPVSLEQVK PA
1
181-191 (11) FPGPEHITNEK PA
1
206-220 (15) GLILEVSGHAIYAIR PA
1
226-244 (19) VYWSGPCAPSLVAPNLIER PA
1
250-265 (16) LFCLETFLSDLIAHQK PA
1
271-292 (22) QPPFEIYLCFGEEWPDGKPLER PA
1
294-305 (12) LILVQVIPVVAR PA
1
306-317 (12) MIYEMFSGDFTR PA
1
318-325 (8) SFDSGSVR PA
1
326-334 (9) LQISTPDIK PA
1
335-342 (8) DNIVAQLK PA
1
347-372 (26) ILQTQESWQPMQPTPSMQLPPALPPQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center