Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14948-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
22-56 (35) LLSGSILDVYSGEQGISPINMGLTSASCPSSLPMK PA
0
58-65 (8) EITETDTR PA
3
75-82 (8) DNHNLIER PA
18
94-101 (8) ELGTLIPK PA
16
153-161 (9) IQELEIQAR PA
2
162-182 (21) THGLPTLASLGTVDLGAHVTK PA
2
183-232 (50) QQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALK PA
2
237-264 (28) LDGMLLDDTISPFGTDPLLSATSPAVSK PA
2
270-280 (11) SSFSSDDGDEL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center