Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14974-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-30 (14) WIGSETDLEPPVVK PA
3
38-58 (21) FDDGAVFLAACSSGDTDEVLK PA
3
63-90 (28) GADINYANVDGLTALHQACIDDNVDMVK PA
3
91-161 (71) FLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNR PA
4
162-170 (9) QGVDIEAAR PA
4
183-194 (12) QWLNSGHINDVR PA
4
198-209 (12) SGGTALHVAAAK PA
4
217-228 (12) LLIQAGYDVNIK PA
4
229-244 (16) DYDGWTPLHAAAHWGK PA
4
250-263 (14) ILVDNLCDMEMVNK PA
4
264-285 (22) VGQTAFDVADEDILGYLEELQK PA
4
287-294 (8) QNLLHSEK PA
4
299-315 (17) SPLIESTANMDNNQSQK PA
4
321-329 (9) ETLIIEPEK PA
4
334-341 (8) IESLEQEK PA
4
342-349 (8) VDEEEEGK PA
4
351-373 (23) DESSCSSEEDEEDDSESEAETDK PA
4
374-412 (39) TKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIK PA
4
430-437 (8) DESPATWR PA
4
443-456 (14) TGSYGALAEITASK PA
4
476-483 (8) LSSSLDNK PA
4
494-503 (10) LAYVAPTIPR PA
4
505-514 (10) LASTSDIEEK PA
4
540-551 (12) NSSVNEGSTYHK PA
4
557-565 (9) LWAEDSTEK PA
3
568-607 (40) DSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVR PA
3
619-626 (8) DEESESQR PA
9
639-653 (15) STQGVTLTDLQEAEK PA
4
705-712 (8) TYDETYQR PA
4
713-756 (44) YRPVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSR PA
4
796-823 (28) STGVSFWTQDSDENEQEQQSDTEEGSNK PA
4
825-833 (9) ETQTDSISR PA
4
834-844 (11) YETSSTSAGDR PA
4
852-861 (10) SGSYSYLEER PA
4
879-889 (11) LYEQILAENEK PA
3
892-905 (14) AQLHDTNMELTDLK PA
3
938-946 (9) ISEMEEELK PA
4
960-967 (8) DENGALIR PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center