Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14978-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MASGPGSQER PA
0
18-43 (26) LEEDCAWSQELPPPDPGPSPEASHLR PA
0
49-56 (8) FQEAAGPR PA
0
62-75 (14) LQELCHGWLRPEMR PA
0
78-100 (23) EQILELLVLEQFLTILPQEIQSR PA
0
101-121 (21) VQELHPESGEEAVTLVEDMQR PA
0
128-135 (8) QQVTNHGR PA
0
136-151 (16) GTEVLLEEPLPLETAR PA
0
158-165 (8) LEPMETER PA
0
171-181 (11) LQELLGPSPQR PA
0
190-208 (19) ALSAPWLSLFPPEGNMEDK PA
0
209-238 (30) EMTGPQLPESLEDVAMYISQEEWGHQDPSK PA
0
244-275 (32) DTVQESYENVDSLESHIPSQEVPGTQVGQGGK PA
0
276-285 (10) LWDPSVQSCK PA
0
292-299 (8) GPAPGEEK PA
0
300-325 (26) FENLEGVPSVCSENIHPQVLLPDQAR PA
0
326-340 (15) GEVPWSPELGRPHDR PA
0
341-364 (24) SQGDWAPPPEGGMEQALAGASSGR PA
0
377-385 (9) LHLCPLCGK PA
0
386-395 (10) NFSNNSNLIR PA
0
405-420 (16) LCMGVDCTEIFGGNPR PA
0
427-435 (9) AHLGEEAHK PA
0
442-451 (10) CFSQNTHLTR PA
0
455-469 (15) THTGEKPYQCNICGK PA
0
470-479 (10) CFSCNSNLHR PA
0
483-491 (9) THTGEKPYK PA
107
492-507 (16) CPECGEIFAHSSNLLR PA
0
511-519 (9) IHTGERPYK PA
46
530-538 (9) SSHLVIHER PA
0
545-569 (25) LYPFSECGEAVSDSTPFLTNHGAHK PA
0
574-582 (9) LFECLTCGK PA
0
596-604 (9) THTGEKPYK PA
107
605-615 (11) CTLCGENFSHR PA
0
624-646 (23) IHTGEKPYTCHECGDSFSHSSNR PA
0
652-660 (9) THTGERPYK PA
20
661-670 (10) CSECGESFSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center