Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14983-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-30 (23) TTEECLAYFGVSETTGLTPDQVK PA
1
36-47 (12) YGLNELPAEEGK PA
1
48-63 (16) TLWELVIEQFEDLLVR PA
1
64-110 (47) ILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQER PA
1
111-120 (10) NAENAIEALK PA
6
121-128 (8) EYEPEMGK PA
13
144-158 (15) DIVPGDIVEVAVGDK PA
9
175-189 (15) VDQSILTGESVSVIK PA
6
190-198 (9) HTEPVPDPR PA
2
206-218 (13) NMLFSGTNIAAGK PA
7
219-234 (16) ALGIVATTGVGTEIGK PA
2
237-246 (10) DQMAATEQDK PA
2
253-262 (10) LDEFGEQLSK PA
7
263-290 (28) VISLICVAVWLINIGHFNDPVHGGSWFR PA
2
298-324 (27) IAVALAVAAIPEGLPAVITTCLALGTR PA
14
335-352 (18) SLPSVETLGCTSVICSDK PA
14
353-365 (13) TGTLTTNQMSVCK PA
2
372-397 (26) VDGDICLLNEFSITGSTYAPEGEVLK PA
2
398-431 (34) NDKPVRPGQYDGLVELATICALCNDSSLDFNEAK PA
2
437-451 (15) VGEATETALTTLVEK PA
2
452-460 (9) MNVFNTDVR PA
2
468-476 (9) ANACNSVIR PA
2
482-489 (8) EFTLEFSR PA
14
493-502 (10) SMSVYCSPAK PA
2
516-524 (9) GAPEGVIDR PA
7
535-542 (8) VPLTGPVK PA
2
574-583 (10) EEMVLDDSAR PA
2
584-604 (21) FLEYETDLTFVGVVGMLDPPR PA
2
606-615 (10) EVTGSIQLCR PA
2
621-629 (9) VIMITGDNK PA
7
630-637 (8) GTAIAICR PA
2
639-651 (13) IGIFGENEEVADR PA
2
657-667 (11) EFDDLPLAEQR PA
2
687-712 (26) IVEYLQSYDEITAMTGDGVNDAPALK PA
2
714-728 (15) AEIGIAMGSGTAVAK PA
14
729-751 (23) TASEMVLADDNFSTIVAAVEEGR PA
7
763-822 (60) YLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPR PA
2
826-836 (11) EPLISGWLFFR PA
7
837-924 (88) YMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSL
SENQSLLR PA
2
925-958 (34) MPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK PA
2
961-972 (12) ALDLTQWLMVLK PA
2
973-985 (13) ISLPVIGLDEILK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center