Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O14983-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
19-33 (15) DIVPGDIVEVAVGDK PA
9
50-64 (15) VDQSILTGESVSVIK PA
6
65-73 (9) HTEPVPDPR PA
2
81-93 (13) NMLFSGTNIAAGK PA
7
94-109 (16) ALGIVATTGVGTEIGK PA
2
112-121 (10) DQMAATEQDK PA
2
128-137 (10) LDEFGEQLSK PA
7
138-165 (28) VISLICVAVWLINIGHFNDPVHGGSWFR PA
2
173-199 (27) IAVALAVAAIPEGLPAVITTCLALGTR PA
14
210-227 (18) SLPSVETLGCTSVICSDK PA
14
228-240 (13) TGTLTTNQMSVCK PA
2
247-272 (26) VDGDICLLNEFSITGSTYAPEGEVLK PA
2
273-306 (34) NDKPVRPGQYDGLVELATICALCNDSSLDFNEAK PA
2
312-326 (15) VGEATETALTTLVEK PA
2
327-335 (9) MNVFNTDVR PA
2
343-351 (9) ANACNSVIR PA
2
357-364 (8) EFTLEFSR PA
14
368-377 (10) SMSVYCSPAK PA
2
391-399 (9) GAPEGVIDR PA
7
410-417 (8) VPLTGPVK PA
2
449-458 (10) EEMVLDDSAR PA
2
459-479 (21) FLEYETDLTFVGVVGMLDPPR PA
2
481-490 (10) EVTGSIQLCR PA
2
496-504 (9) VIMITGDNK PA
7
505-512 (8) GTAIAICR PA
2
514-526 (13) IGIFGENEEVADR PA
2
532-542 (11) EFDDLPLAEQR PA
2
562-587 (26) IVEYLQSYDEITAMTGDGVNDAPALK PA
2
589-603 (15) AEIGIAMGSGTAVAK PA
14
604-626 (23) TASEMVLADDNFSTIVAAVEEGR PA
7
638-697 (60) YLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPR PA
2
701-711 (11) EPLISGWLFFR PA
7
712-799 (88) YMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSL
SENQSLLR PA
2
800-833 (34) MPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFK PA
2
836-847 (12) ALDLTQWLMVLK PA
2
848-860 (13) ISLPVIGLDEILK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center