Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15069-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-21 (14) AELLLPEADRPGPR PA
0
22-39 (18) TDLSCDAAAATTILGGDR PA
0
41-118 (78) EPCALTPGPSHLALTFLPSKPGARPQPEGASWDAGPGGAPSAWADPGEGGPSPMLLPEGLSSQALSTEAPLPATLEPR PA
0
119-133 (15) IVMGEETCQALLSPR PA
0
141-182 (42) DQEGGHASPDPPPELCSQGDLSVPSPPPDPDSFFTPPSTPTK PA
0
183-198 (16) TTYALLPACGPHGDAR PA
0
206-263 (58) DELLDSPPASPSGSYITADGDSWASSPSCSLSLLAPAEGLDFPSGWGLSPQGSMVDER PA
0
264-381 (118) ELHPAGTPEPPSSESSLSADSSSSWGQEGHFFDLDFLANDPMIPAALLPFQGSLIFQVEAVEVTPLSPEEEEEEAVADPDPGGDLAGEGEEDSTSASFLQSLSDLSITEGMDEAFAFR PA
0
382-403 (22) DDTSAASSDSDSASYAEADDER PA
0
404-422 (19) LYSGEPHAQATLLQDSVQK PA
0
423-432 (10) TEEESGGGAK PA
0
433-454 (22) GLQAQDGTVSWAVEAAPQTSDR PA
0
462-501 (40) QELISEVTEEGLALGQESTATVTPHTLQVAPGLQVEVATR PA
0
502-545 (44) VTPQAGEEETDSTAGQESAAMAMPQPSQEGISEILGQESVTAEK PA
0
546-566 (21) LPTPQEETSLTLCPDSPQNLK PA
0
567-577 (11) EEGGLDLPSGR PA
0
578-588 (11) KPVAAATIVPR PA
0
592-982 (391) EDLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATIVSQQAEEGLTLPQDSVMTPPLPLQDTELSSAPKPVAAATLVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATLVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATLVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATIVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATIVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATPVSQQAEEGLTLPQDSAMTPPLPLQDTDLSSAPKPVAAATPVSQQAEEGLTLPQDSAMTAPLPLQDTGPTSGPEPLAVATPQTLQAEAGCAPGTEPVATMAQQEVGEALGPRPAPEEK PA
0
983-1050 (68) NAALPTVPEPAALDQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGR PA
0
1058-1071 (14) AHTGDGAKPDSPQK PA
0
1072-1094 (23) ETLEVENQQEGGLKPLAQEHGPR PA
0
1102-1118 (17) EVPDAPPAACPEVSQAR PA
0
1133-1165 (33) STPEPTLPSAVATEASLDSCPESSVGAVSSLDR PA
0
1166-1214 (49) GCPDAPAPTSAPTSQQPEPVLGLGSVEQPHEVPSVLGTPLLQPPENLAK PA
0
1215-1296 (82) GQPSTPVDRPLGPDPSAPGTLAGAALPPLEPPAPCLCQDPQEDSVEDEEPPGSLGLPPPQAGVQPAAAAVSGTTQPLGTGPR PA
0
1297-1309 (13) VSLSPHSPLLSPK PA
0
1317-1361 (45) DLALQILPPCQVPPPSGPQSPAGPQGLSAPEQQEDEDSLEEDSPR PA
0
1362-1407 (46) ALGSGQHSDSHGESSAELDEQDILAPQTVQCPAQAPAGGSEETIAK PA
0
1442-1454 (13) NILFVIAKPDVFK PA
0
1455-1468 (14) SPASDTYVVFGEAK PA
0
1469-1478 (10) IEDLSQQVHK PA
0
1486-1502 (17) VPSEPSALVPESAPRPR PA
0
1509-1526 (18) EEEEEEEEEVDEAGLELR PA
0
1527-1539 (13) DIELVMAQANVSR PA
0
1548-1562 (15) DNHSDIVNAIMELTM PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center