Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15126-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MSDFDSNPFADPDLNNPFK PA
1
20-28 (9) DPSVTQVTR PA
1
29-44 (16) NVPPGLDEYNPFSDSR PA
1
45-52 (8) TPPPGGVK PA
1
53-78 (26) MPNVPNTQPAIMKPTEEHPAYTQIAK PA
1
79-89 (11) EHALAQAELLK PA
1
107-116 (10) EMQNLSQHGR PA
1
118-147 (30) NNWPPLPSNFPVGPCFYQDFSVDIPVEFQK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center