Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15143-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MAYHSFLVEPISCHAWNK PA
0
21-37 (17) TQIAICPNNHEVHIYEK PA
0
50-66 (17) EHNGQVTGIDWAPESNR PA
0
67-74 (8) IVTCGTDR PA
0
75-82 (8) NAYVWTLK PA
0
85-94 (10) TWKPTLVILR PA
0
111-118 (8) FAVGSGSR PA
0
119-135 (17) VISICYFEQENDWWVCK PA
0
143-165 (23) STVLSLDWHPNNVLLAAGSCDFK PA
2
175-188 (14) EVEERPAPTPWGSK PA
0
189-216 (28) MPFGELMFESSSSCGWVHGVCFSASGSR PA
0
217-233 (17) VAWVSHDSTVCLADADK PA
0
235-284 (50) MAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGR PA
0
309-326 (18) ASSEGGTAAGAGLDSLHK PA
0
327-339 (13) NSVSQISVLSGGK PA
0
342-360 (19) CSQFCTTGMDGGMSIWDVK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center