Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15360-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MSDSWVPNSASGQDPGGR PA
2
21-29 (9) AWAELLAGR PA
2
53-70 (18) SHQDLNALLLEVEGPLCK PA
2
77-104 (28) VIDCDSSEAYANHSSSFIGSALQDQASR PA
2
105-142 (38) LGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVEQR PA
2
145-163 (19) LSSLLEFAQYLLAHSMFSR PA
2
164-172 (9) LSFCQELWK PA
2
173-212 (40) IQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFR PA
2
213-232 (20) NLCCLCEQMEASCQHADVAR PA
2
233-245 (13) AMLSDFVQMFVLR PA
2
262-272 (11) MPQVTVDVLQR PA
2
273-293 (21) MLIFALDALAAGVQEESSTHK PA
2
297-317 (21) CWFGVFSGHTLGSVISTDPLK PA
1
319-335 (17) FFSHTLTQILTHSPVLK PA
1
336-344 (9) ASDAVQMQR PA
1
351-360 (10) THPLLTSLYR PA
1
362-388 (27) LFVMLSAEELVGHLQEVLETQEVHWQR PA
1
389-413 (25) VLSFVSALVVCFPEAQQLLEDWVAR PA
1
414-435 (22) LMAQAFESCQLDSMVTAFLVVR PA
1
436-453 (18) QAALEGPSAFLSYADWFK PA
1
469-487 (19) ALVFLFTFLSELVPFESPR PA
1
488-502 (15) YLQVHILHPPLVPGK PA
1
505-515 (11) SLLTDYISLAK PA
1
523-553 (31) VSIENMGLYEDLSSAGDITEPHSQALQDVEK PA
1
554-575 (22) AIMVFEHTGNIPVTVMEASIFR PA
1
576-591 (16) RPYYVSHFLPALLTPR PA
1
601-608 (8) VAFIESLK PA
1
613-640 (28) IPPSLYSTYCQACSAAEEKPEDAALGVR PA
1
641-661 (21) AEPNSAEEPLGQLTAALGELR PA
1
662-670 (9) ASMTDPSQR PA
1
671-683 (13) DVISAQVAVISER PA
1
686-701 (16) AVLGHNEDDSSVEISK PA
1
702-710 (9) IQLSINTPR PA
1
715-741 (27) EHMAVDLLLTSFCQNLMAASSVAPPER PA
1
742-751 (10) QGPWAALFVR PA
1
757-764 (8) VLPAVLTR PA
1
771-795 (25) HQGPSLSAPHVLGLAALAVHLGESR PA
1
796-825 (30) SALPEVDVGPPAPGAGLPVPALFDSLLTCR PA
1
828-835 (8) DSLFFCLK PA
1
836-847 (12) FCTAAISYSLCK PA
1
854-866 (13) DTLCSCLSPGLIK PA
1
881-905 (25) QPLSEEDVASLSWRPLHLPSADWQR PA
1
906-914 (9) AALSLWTHR PA
1
922-951 (30) EEDVHLTYQDWLHLELEIQPEADALSDTER PA
1
952-996 (45) QDFHQWAIHEHFLPESSASGGCDGDLQAACTILVNALMDFHQSSR PA
1
997-1011 (15) SYDHSENSDLVFGGR PA
1
1012-1020 (9) TGNEDIISR PA
1
1021-1053 (33) LQEMVADLELQQDLIVPLGHTPSQEHFLFEIFR PA
1
1056-1071 (16) LQALTSGWSVAASLQR PA
1
1085-1104 (20) LPSSVLCGSSFQAEQPITAR PA
1
1105-1117 (13) CEQFFHLVNSEMR PA
1
1118-1136 (19) NFCSHGGALTQDITAHFFR PA
1
1137-1144 (8) GLLNACLR PA
1
1147-1158 (12) DPSLMVDFILAK PA
1
1163-1184 (22) CPLILTSALVWWPSLEPVLLCR PA
1
1188-1195 (8) HCQSPLPR PA
1
1205-1238 (34) QFASDFLSPEAASPAPNPDWLSAAALHFAIQQVR PA
1
1254-1283 (30) EELLVFLFFFSLMGLLSSHLTSNSTTDLPK PA
1
1284-1297 (14) AFHVCAAILECLEK PA
1
1300-1314 (15) ISWLALFQLTESDLR PA
1
1322-1329 (8) VAPDQHTR PA
1
1330-1349 (20) LLPFAFYSLLSYFHEDAAIR PA
1
1350-1363 (14) EEAFLHVAVDMYLK PA
1
1364-1382 (19) LVQLFVAGDTSTVSPPAGR PA
1
1388-1398 (11) GQGNPVELITK PA
0
1401-1409 (9) LFLLQLIPR PA
0
1414-1425 (12) SFSHVAELLADR PA
0
1426-1439 (14) GDCDPEVSAALQSR PA
0
1440-1455 (16) QQAAPDADLSQEPHLF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center