Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15360-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MSDSWVPNSASGQDPGGR PA
2
21-29 (9) AWAELLAGR PA
2
53-70 (18) SHQDLNALLLEVEGPLCK PA
2
77-104 (28) VIDCDSSEAYANHSSSFIGSALQDQASR PA
2
105-142 (38) LGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVEQR PA
2
145-163 (19) LSSLLEFAQYLLAHSMFSR PA
2
164-172 (9) LSFCQELWK PA
2
173-212 (40) IQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFR PA
2
213-232 (20) NLCCLCEQMEASCQHADVAR PA
2
233-245 (13) AMLSDFVQMFVLR PA
2
262-272 (11) MPQVTVDVLQR PA
2
273-293 (21) MLIFALDALAAGVQEESSTHK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center