Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15409-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MMQESATETISNSSMNQNGMSTLSSQLDAGSR PA
6
36-62 (27) SSGDTSSEVSTVELLHLQQQQALQAAR PA
6
63-74 (12) QLLLQQQTSGLK PA
6
82-140 (59) QRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK PA
2
142-195 (54) QQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGK PA
5
199-238 (40) EQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQR PA
5
239-271 (33) QGLISIPPGQAALPVQSLPQAGLSPAEIQQLWK PA
5
272-285 (14) EVTGVHSMEDNGIK PA
5
286-306 (21) HGGLDLTTNNSSSTTSSNTSK PA
5
307-327 (21) ASPPITHHSIVNGQSSVLSAR PA
5
329-349 (21) DSSSHEETGASHTLYGHGVCK PA
5
350-365 (16) WPGCESICEDFGQFLK PA
5
366-376 (11) HLNNEHALDDR PA
4
383-397 (15) VQMQVVQQLEIQLSK PA
4
402-433 (32) LQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSK PA
3
434-476 (43) NMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIR PA
3
483-499 (17) YNIPMSSEIAPNYEFYK PA
3
500-514 (15) NADVRPPFTYATLIR PA
3
515-523 (9) QAIMESSDR PA
3
524-536 (13) QLTLNEIYSWFTR PA
3
570-582 (13) GAVWTVDEVEYQK PA
3
588-596 (9) ITGSPTLVK PA
3
597-674 (78) NIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVK PA
3
675-703 (29) EEPVIAEDEDCPMSLVTTANHSPELEDDR PA
3
704-715 (12) EIEEEPLSEDLE PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center