Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15409-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-48 (48) MMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK PA
0
50-103 (54) QQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGK PA
5
107-146 (40) EQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQR PA
5
147-179 (33) QGLISIPPGQAALPVQSLPQAGLSPAEIQQLWK PA
5
180-193 (14) EVTGVHSMEDNGIK PA
5
194-214 (21) HGGLDLTTNNSSSTTSSNTSK PA
5
215-235 (21) ASPPITHHSIVNGQSSVLSAR PA
5
237-257 (21) DSSSHEETGASHTLYGHGVCK PA
5
258-273 (16) WPGCESICEDFGQFLK PA
5
274-284 (11) HLNNEHALDDR PA
4
291-305 (15) VQMQVVQQLEIQLSK PA
4
310-341 (32) LQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSK PA
3
342-384 (43) NMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIR PA
3
391-407 (17) YNIPMSSEIAPNYEFYK PA
3
408-422 (15) NADVRPPFTYATLIR PA
3
423-431 (9) QAIMESSDR PA
3
432-444 (13) QLTLNEIYSWFTR PA
3
478-490 (13) GAVWTVDEVEYQK PA
3
496-504 (9) ITGSPTLVK PA
3
505-582 (78) NIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVK PA
3
583-611 (29) EEPVIAEDEDCPMSLVTTANHSPELEDDR PA
3
612-623 (12) EIEEEPLSEDLE PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center