Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15409-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MMQESATETISNSSMNQNGMSTLSSQLDAGSR PA
6
36-62 (27) SSGDTSSEVSTVELLHLQQQQALQAAR PA
6
63-74 (12) QLLLQQQTSGLK PA
6
82-93 (12) QRPLQELLPETK PA
1
94-165 (72) LCICGHSSGDGHPHNTFAVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQQQLQEFYK PA
0
167-220 (54) QQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGK PA
5
224-263 (40) EQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQR PA
5
264-296 (33) QGLISIPPGQAALPVQSLPQAGLSPAEIQQLWK PA
5
297-310 (14) EVTGVHSMEDNGIK PA
5
311-331 (21) HGGLDLTTNNSSSTTSSNTSK PA
5
332-352 (21) ASPPITHHSIVNGQSSVLSAR PA
5
354-374 (21) DSSSHEETGASHTLYGHGVCK PA
5
375-390 (16) WPGCESICEDFGQFLK PA
5
391-401 (11) HLNNEHALDDR PA
4
408-422 (15) VQMQVVQQLEIQLSK PA
4
427-458 (32) LQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSK PA
3
459-501 (43) NMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIR PA
3
508-524 (17) YNIPMSSEIAPNYEFYK PA
3
525-539 (15) NADVRPPFTYATLIR PA
3
540-548 (9) QAIMESSDR PA
3
549-561 (13) QLTLNEIYSWFTR PA
3
595-607 (13) GAVWTVDEVEYQK PA
3
613-621 (9) ITGSPTLVK PA
3
622-699 (78) NIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVK PA
3
700-728 (29) EEPVIAEDEDCPMSLVTTANHSPELEDDR PA
3
729-740 (12) EIEEEPLSEDLE PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center