Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15409-9)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-32 (32) MMQESATETISNSSMNQNGMSTLSSQLDAGSR PA
6
36-62 (27) SSGDTSSEVSTVELLHLQQQQALQAAR PA
6
63-74 (12) QLLLQQQTSGLK PA
6
82-143 (62) QRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQALLQQQQAVMLQQDFLDSGLENFR PA
0
149-157 (9) NQQLQEFYK PA
0
159-212 (54) QQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHPGK PA
5
216-255 (40) EQQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQR PA
5
256-288 (33) QGLISIPPGQAALPVQSLPQAGLSPAEIQQLWK PA
5
289-302 (14) EVTGVHSMEDNGIK PA
5
303-323 (21) HGGLDLTTNNSSSTTSSNTSK PA
5
324-344 (21) ASPPITHHSIVNGQSSVLSAR PA
5
346-366 (21) DSSSHEETGASHTLYGHGVCK PA
5
367-382 (16) WPGCESICEDFGQFLK PA
5
383-393 (11) HLNNEHALDDR PA
4
400-414 (15) VQMQVVQQLEIQLSK PA
4
419-450 (32) LQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSK PA
3
451-493 (43) NMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIR PA
3
500-516 (17) YNIPMSSEIAPNYEFYK PA
3
517-531 (15) NADVRPPFTYATLIR PA
3
532-540 (9) QAIMESSDR PA
3
541-553 (13) QLTLNEIYSWFTR PA
3
587-599 (13) GAVWTVDEVEYQK PA
3
605-613 (9) ITGSPTLVK PA
3
614-691 (78) NIPTSLGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVK PA
3
692-720 (29) EEPVIAEDEDCPMSLVTTANHSPELEDDR PA
3
721-732 (12) EIEEEPLSEDLE PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center