Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15442-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-36 (24) AEALALLPCGLGMAFSQSHVMAAR PA
1
43-67 (25) LIIEVDEYSSNPTQAFTFYNINQGR PA
1
68-91 (24) FQPPHVQMVDPVPHDAPKPPGYTR PA
1
92-101 (10) FVCVSDTHSR PA
1
102-129 (28) TDPIQMPYGDVLIHAGDFTELGLPSEVK PA
1
131-143 (13) FNEWLGSLPYEYK PA
1
144-164 (21) IVIAGNHELTFDQEFMADLIK PA
1
165-175 (11) QDFYYFPSVSK PA
1
176-202 (27) LKPENYENVQSLLTNCIYLQDSEVTVR PA
1
206-224 (19) IYGSPWQPWFYGWGFNLPR PA
1
232-257 (26) WNLIPEGVDILITHGPPLGFLDWVPK PA
1
262-273 (12) VGCVELLNTVQR PA
3
279-324 (46) LHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center