Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15442-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-25 (14) SGGGPGCGGGSGGR PA
0
46-69 (24) AEALALLPCGLGMAFSQSHVMAAR PA
1
76-100 (25) LIIEVDEYSSNPTQAFTFYNINQGR PA
1
101-124 (24) FQPPHVQMVDPVPHDAPKPPGYTR PA
1
125-134 (10) FVCVSDTHSR PA
1
135-162 (28) TDPIQMPYGDVLIHAGDFTELGLPSEVK PA
1
164-176 (13) FNEWLGSLPYEYK PA
1
177-197 (21) IVIAGNHELTFDQEFMADLIK PA
1
198-208 (11) QDFYYFPSVSK PA
1
209-235 (27) LKPENYENVQSLLTNCIYLQDSEVTVR PA
1
239-257 (19) IYGSPWQPWFYGWGFNLPR PA
1
265-290 (26) WNLIPEGVDILITHGPPLGFLDWVPK PA
1
295-306 (12) VGCVELLNTVQR PA
3
312-357 (46) LHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center