Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15444-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-44 (44) MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLR PA
2
51-69 (19) IQEVSGSCNLPAAIFYLPK PA
1
100-115 (16) LHHNTQTFQAGPHAVK PA
0
129-137 (9) FSNPISSSK PA
1
139-150 (12) NVSLLISANSGL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center