Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15446-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MEEPQAGDAAR PA
0
12-29 (18) FSCPPNFTAKPPASESPR PA
1
30-59 (30) FSLEALTGPDTELWLIQAPADFAPECFNGR PA
1
60-70 (11) HVPLSGSQIVK PA
1
82-116 (35) VLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLR PA
1
117-148 (32) ILEGPQQSLSGSPLQPIPASPPPQIPPGLRPR PA
1
149-162 (14) FCAFGGNPPVTGPR PA
1
163-174 (12) SALAPNLLTSGK PA
1
178-211 (34) EMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVR PA
1
223-251 (29) EPEAAGPVGTEPTVETLEPLGVLFPSTTK PA
1
260-267 (8) ETFEPEDK PA
1
271-288 (18) QEQINTEPLEDTVLSPTK PA
1
295-314 (20) GTEGMEPEEGVTVESQPQVK PA
1
315-328 (14) VEPLEEAIPLPPTK PA
1
335-384 (50) GQMAMMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPK PA
1
392-422 (31) QQDATVEPETEVVGPELPDDLEPQAAPTSTK PA
1
431-454 (24) GHTVTEPIQPLEPELPGEGQPEAR PA
1
472-498 (27) MPETVPQEEMPGPPLNSESGEEAPTGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center