Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15446-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MEEPQAGGEDAAR PA
0
14-31 (18) FSCPPNFTAKPPASESPR PA
1
32-61 (30) FSLEALTGPDTELWLIQAPADFAPECFNGR PA
1
62-72 (11) HVPLSGSQIVK PA
1
84-118 (35) VLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLR PA
1
119-150 (32) ILEGPQQSLSGSPLQPIPASPPPQIPPGLRPR PA
1
151-164 (14) FCAFGGNPPVTGPR PA
1
165-176 (12) SALAPNLLTSGK PA
1
180-213 (34) EMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVR PA
1
225-253 (29) EPEAAGPVGTEPTVETLEPLGVLFPSTTK PA
1
262-269 (8) ETFEPEDK PA
1
273-290 (18) QEQINTEPLEDTVLSPTK PA
1
297-316 (20) GTEGMEPEEGVTVESQPQVK PA
1
317-330 (14) VEPLEEAIPLPPTK PA
1
337-386 (50) GQMAMMEPGTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPK PA
1
394-424 (31) QQDATVEPETEVVGPELPDDLEPQAAPTSTK PA
1
433-456 (24) GHTVTEPIQPLEPELPGEGQPEAR PA
1
474-500 (27) MPETVPQEEMPGPPLNSESGEEAPTGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center