Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15503-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-18 (15) LHDHFWSCSCAHSAR PA
1
25-33 (9) ASAAGLAAK PA
1
34-61 (28) VGEMINVSVSGPSLLAAHGAPDADPAPR PA
1
64-83 (20) SAAMSGPEPGSPYPNTWHHR PA
1
88-109 (22) SLVLFSVGVVLALVLNLLQIQR PA
1
110-156 (47) NVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHK PA
0
167-180 (14) CIAVFVGINHASAK PA
0
181-206 (26) LDFANNVQLSLTLAALSLGLWWTFDR PA
0
209-245 (37) SGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIR PA
0
246-264 (19) SWLPCIFFSGGVTVGNIGR PA
0
265-277 (13) QLAMGVPEKPHSD PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center