Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15529-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-42 (42) MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGK PA
1
45-71 (27) CRPVAVDVLLLNLTASDLLLLLFLPFR PA
0
72-113 (42) MVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIER PA
1
114-124 (11) FLSVAHPLWYK PA
1
129-175 (47) LGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWK PA
0
176-185 (10) DQLAILLPVR PA
1
186-206 (21) LEMAVVLFVVPLIITSYCYSR PA
1
223-258 (36) VAGLVAATLLNFLVCFGPYNVSHVVGYICGESPVWR PA
0
259-292 (34) IYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLR PA
1
294-310 (17) LCGLWGQWQQESSMELK PA
1
328-346 (19) TSEHSQGCGTGGQVACAEN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center