Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15530-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-30 (27) TTSQLYDAVPIQSSVVLCSCPSPSMVR PA
3
31-46 (16) TQTESSTPPGIPGGSR PA
3
47-75 (29) QGPAMDGTAAEPRPGAGSLQHAQPPPQPR PA
3
87-100 (14) ILGEGSFSTVVLAR PA
4
137-144 (8) LDHPFFVK PA
3
145-154 (10) LYFTFQDDEK PA
3
155-163 (9) LYFGLSYAK PA
3
174-183 (10) IGSFDETCTR PA
3
184-199 (16) FYTAEIVSALEYLHGK PA
3
205-228 (24) DLKPENILLNEDMHIQITDFGTAK PA
3
239-257 (19) ANSFVGTAQYVSPELLTEK PA
3
262-283 (22) SSDLWALGCIIYQLVAGLPPFR PA
3
284-293 (10) AGNEYLIFQK PA
4
297-304 (8) LEYDFPEK PA
4
316-323 (8) LLVLDATK PA
4
325-337 (13) LGCEEMEGYGPLK PA
4
338-357 (20) AHPFFESVTWENLHQQTPPK PA
4
358-407 (50) LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQR PA
4
408-435 (28) SGSNIEQYIHDLDSNSFELDLQFSEDEK PA
4
442-459 (18) QAGGNPWHQFVENNLILK PA
3
475-492 (18) QLLLTEGPHLYYVDPVNK PA
3
496-509 (14) GEIPWSQELRPEAK PA
3
513-521 (9) TFFVHTPNR PA
3
522-534 (13) TYYLMDPSGNAHK PA
3
547-556 (10) YQSHPDAAVQ PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center