Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15530-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MDGTAAEPRPGAGSLQHAQPPPQPR PA
0
37-50 (14) ILGEGSFSTVVLAR PA
4
87-94 (8) LDHPFFVK PA
3
95-104 (10) LYFTFQDDEK PA
3
105-113 (9) LYFGLSYAK PA
3
124-133 (10) IGSFDETCTR PA
3
134-149 (16) FYTAEIVSALEYLHGK PA
3
155-178 (24) DLKPENILLNEDMHIQITDFGTAK PA
3
189-207 (19) ANSFVGTAQYVSPELLTEK PA
3
212-233 (22) SSDLWALGCIIYQLVAGLPPFR PA
3
234-243 (10) AGNEYLIFQK PA
4
247-254 (8) LEYDFPEK PA
4
266-273 (8) LLVLDATK PA
4
275-287 (13) LGCEEMEGYGPLK PA
4
288-307 (20) AHPFFESVTWENLHQQTPPK PA
4
308-357 (50) LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQR PA
4
358-385 (28) SGSNIEQYIHDLDSNSFELDLQFSEDEK PA
4
392-409 (18) QAGGNPWHQFVENNLILK PA
3
425-442 (18) QLLLTEGPHLYYVDPVNK PA
3
446-459 (14) GEIPWSQELRPEAK PA
3
463-471 (9) TFFVHTPNR PA
3
472-484 (13) TYYLMDPSGNAHK PA
3
497-506 (10) YQSHPDAAVQ PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center