Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15530-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-30 (27) TTSQLYDAVPIQSSVVLCSCPSPSMVR PA
3
31-46 (16) TQTESSTPPGIPGGSR PA
3
47-75 (29) QGPAMDGTAAEPRPGAGSLQHAQPPPQPR PA
3
87-100 (14) ILGEGSFSTVVLAR PA
4
112-130 (19) ANSFVGTAQYVSPELLTEK PA
3
135-156 (22) SSDLWALGCIIYQLVAGLPPFR PA
3
157-166 (10) AGNEYLIFQK PA
4
170-177 (8) LEYDFPEK PA
4
189-196 (8) LLVLDATK PA
4
198-210 (13) LGCEEMEGYGPLK PA
4
211-230 (20) AHPFFESVTWENLHQQTPPK PA
4
231-280 (50) LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQR PA
4
281-308 (28) SGSNIEQYIHDLDSNSFELDLQFSEDEK PA
4
315-332 (18) QAGGNPWHQFVENNLILK PA
3
348-365 (18) QLLLTEGPHLYYVDPVNK PA
3
369-382 (14) GEIPWSQELRPEAK PA
3
386-394 (9) TFFVHTPNR PA
3
395-407 (13) TYYLMDPSGNAHK PA
3
420-429 (10) YQSHPDAAVQ PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center