Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15544-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-11 (9) EALHQIVVR PA
0
12-23 (12) CSELVSSTSLPR PA
0
29-47 (19) LQGPPDSQPLGTLGQGGWK PA
0
48-80 (33) LLGIVGSLAPETLGGLGTEFGPCTHPLPFDMVR PA
0
90-101 (12) QGWLLQCPQCAR PA
0
102-149 (48) TLLCHCGPFLTPPSQTSSSGFQLCSLKPSGSLVTATEPLSNFAFSYFP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center