Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15551-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MSMGLEITGTALAVLGWLGTIVCCALPMWR PA
0
31-64 (34) VSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCK PA
0
65-80 (16) VYDSLLALPQDLQAAR PA
3
81-113 (33) ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAK PA
0
116-144 (29) ITIVAGVLFLLAALLTLVPVSWSANTIIR PA
0
145-156 (12) DFYNPVVPEAQK PA
0
158-187 (30) EMGAGLYVGWAAAALQLLGGALLCCSCPPR PA
0
203-216 (14) STGPGASLGTGYDR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center